DPCstruct | MC30519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 213 ± 46 aa |
| Standard deviation of domain lengths | 46.16 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820HKS9 | 24-204 | FLSILRPELIVPSIVDKLFTSIDDIVEAHRFTSLMFCVTRISRQLVRQTHSYSHGQTYVVPLLLSVLPGIDFNDIDKTSVTIDFLDT… |
| Q5A2T3 | 567-835 | KLSRNVVKEFVSILLPIVKIGIQSKKEKVGSDYISALQLLAFLEPEYVLENTLLDMYESIEGVISTHRVSTALSTIETLSRFIVSTP… |
| A0A287WB51 | 391-660 | None |
| A0A820RUR2 | 92-269 | None |
| A0A7R8Z983 | 50-214 | None |
| A0A1B8DLJ0 | 2-255 | None |
| I1N058 | 363-632 | None |
| A0A3P6S7R1 | 188-356 | None |
| A0A4Z0ABK2 | 59-331 | None |
| A0A820AE08 | 233-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.