DPCstruct | MC30518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 139 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 57.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N5JD20 | 419-559 | KVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDM… |
| T1IN05 | 268-408 | KMLFAVGIALSLLNLPLEYLTLWFDMPYMLLLSDIRQGIFYATLLSFWLVFAGEHMMDNIERNRISAYWKHLSAVVFGCMSLFVFDM… |
| A0A2K5REE5 | 184-324 | None |
| A0A2U9BKW1 | 832-972 | None |
| A0A834ML25 | 20-162 | None |
| A0A4U8UHW0 | 1-139 | None |
| F1LCD1 | 4-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.