DPCstruct | MC30515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 284 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820GFV7 | 2-273 | QIYITELTSDWISRLSDEIGLGEPIQRLLQSSTRLSVRKLRCIPAYPSLLVIRFEWFVKNIPLFLVVRRFCTQGYHNAFYRISVKPT… |
| A0A0L0HT51 | 320-620 | IWVSRLSCSFMEKLCGAMGMPRSVERAVRETVRVSARGIAAVPTFLTIPAIRHAWVMRDIPTFLLVYRFCPQGYHANYFRIEPHPTT… |
| A0A0U5J6J4 | 218-483 | None |
| A0A151GGV2 | 385-657 | None |
| A0A401KJN4 | 68-340 | None |
| A0A5M3YTC4 | 340-608 | None |
| R1EWZ3 | 1-276 | None |
| A0A2K1QHK3 | 197-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.