DPCstruct | MC30514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 240 ± 22 aa |
| Standard deviation of domain lengths | 21.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813RAU7 | 1-210 | MSISINSRGNVLVGMPFINRIYLLSVNISGPRKLTYVSRNTGGRSLGNGKSVAWLDDGNMAAILVNTYSLTYQWSSSQIFFYDMVSN… |
| A0A820GDP6 | 1-254 | GFGQSVAWLDNQGLLAVLVYNPKHQLQPESEIHVFQTLTQNNEMQHVLPNFIFPNNQQTLPKNWTSKSFLLILAHSNNLMILCDRHK… |
| A0A819VQ74 | 586-817 | None |
| A0A822DDU2 | 216-448 | None |
| A0A818WUQ0 | 251-513 | None |
| A0A819BJT8 | 341-585 | None |
| A0A820T845 | 128-376 | None |
| A0A813UAK3 | 571-821 | None |
| A0A814QWA5 | 2-205 | None |
| A0A821RIR5 | 47-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.