DPCstruct | MC30512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820G565 | 8-164 | DEVLMFYDKGNLSELVARMQSDVERTDTNSLLNYHIQLVHLLAMCTEGKNAATEIKCHSLIGLDDLVLIVTHPDCIPEVKNVYITFL… |
| A0A1B0D9Z6 | 420-590 | INAGEDVLVFYNDKVSFNQFVEMMRRYRRGELLDTSPLEYHVELVKLLACCTMGKNVYTEIKCNSLLALDDIVAMISHPDCVPEVKE… |
| A0A0B1SIS5 | 80-245 | None |
| A0A6V7VMF0 | 149-342 | None |
| A0A6J1W8N3 | 12-190 | None |
| A0A821JXQ6 | 1139-1257 | None |
| A0A6I9NCW9 | 190-350 | None |
| A0A060X3H1 | 315-483 | None |
| A0A2D4PZ64 | 1-149 | None |
| X1WET6 | 1338-1498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.