DPCstruct | MC30510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 21.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF16547- PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820FBA9 | 11-136 | QKPDIYNKYSPFYESIKQQAITLFEEIRENLSRTIQLGELEPGFSIWSNKLKQFISHYGFHFTKADHLKLIDYYLSILSITDLNYVH… |
| A0A0L7LC56 | 15-150 | ERIAALGFKPQSEVITNHLLPYADELDAESTAFLKEVKTNLAQAVMLREMKPGCGVWSSRLMRYIRLYGLKFSKEDHIAFIKLAYEL… |
| A0A0M3I1M1 | 2-127 | None |
| A0A1X2GKU8 | 1-110 | None |
| A0A842ZAH8 | 42-165 | None |
| A0A368F7Q5 | 29-184 | None |
| A0A0D2Y8J0 | 16-137 | None |
| A0A553N0R4 | 13-147 | None |
| A0A3Q0JH44 | 34-180 | None |
| A0A0D8XVV1 | 83-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.