DPCstruct | MC3051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.49 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF10143- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4WWP3 | 140-229 | AQITCKYLTEHRCAVRIRASGMSGEVTGTDPLVDYKQLLQSQPLDKSAEALKTSQIINELQKGIIDALSDHPVNIERKKQNKNLANI… |
| A0A2P6TL70 | 152-239 | VSVKYATEHRCGVVVRGPGLSDQISGTDPLKDNLPLLRAQPLDDSPEAAHTAAVVNELSDCMRQVLESHPINAQRVAEGKPPANVVLL |
| A0A6P5XWJ4 | 29-108 | None |
| A0A846PIR0 | 3-98 | None |
| A0A7J6DPR8 | 152-236 | None |
| A0A837A132 | 133-216 | None |
| A0A1V9YLA1 | 151-239 | None |
| A0A287QQM3 | 313-428 | None |
| A0A0D2LWG3 | 95-184 | None |
| A0A2G5F5U9 | 14-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.