DPCstruct | MC30506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336NBE8 | 1-90 | MAKYTIKHICGHTQVHQIYGTNSHGERDNKQEWLANQICYECYKAQQQAERDAKNAESAKANAEAHLPTLTGTPKQIAWAETIRAEK… |
| A0A2C8F4R7 | 2-93 | ETVRHSCGHERKYRLNGPAHSVQRQIEHREAMPCPKCKKAQEEARFVAECEAAALANAEMGLPELTGTASQVSYAEKCRKEAVMFSR… |
| A0A3D9LID5 | 1-83 | None |
| A0A4R7BW26 | 44-146 | None |
| A0A1C5UQK8 | 1-86 | None |
| A0A7X5HWL4 | 1-80 | None |
| D3DA29 | 1-88 | None |
| A0A1P8UK60 | 161-264 | None |
| D5AQX0 | 16-96 | None |
| A0A1V5J9H3 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.