DPCstruct | MC30505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF20154- PF03471 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336N888 | 1-123 | MGLELFTFGVNWLHVSIHQFGDAPLMLSYLLVVVLAAYLSLYPLLFAYLVRRFQVQRAVLYPVLWTLTEFLRGWVLTGFPWLQFGYT… |
| A0A6D0F616 | 51-197 | RRPLQSAAIGFCWGFGLFGTGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTTWLRVAIAAPALWQVTEF… |
| A0A521Y8K9 | 109-252 | None |
| A0A6N9YCY4 | 11-144 | None |
| A0A0K1J162 | 337-483 | None |
| A0A812NK11 | 286-433 | None |
| D0W1M1 | 65-188 | None |
| F9QA62 | 1-125 | None |
| A0A379LGI9 | 3-121 | None |
| D4TC47 | 5-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.