DPCstruct | MC30501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A439JQT0 | 1-106 | MTNQDIFDKVAAHLLTQNAQAREPISGHCAYRGANSMVCAVGCLIPDDKYYPEMEGKGPSDLHEVYGLFPDESIDLLNELQMVHDHY… |
| A0A1H4SIA2 | 3-115 | LTKQEIFDTVATGLVAQGVRSINHNNDCRYRGPNGTKCALGILITDDEYVREMEGHSAWSAIPAFELVRFNNHVEFLAAIQDAHDNH… |
| A0A7W8UQX2 | 11-135 | None |
| A0A7Z8W0E0 | 15-147 | None |
| A0A522RPA2 | 7-117 | None |
| A0A261R5P3 | 16-117 | None |
| A0A7W6EG23 | 8-131 | None |
| A0A842HZV2 | 1-141 | None |
| B1G5L3 | 11-124 | None |
| A0A809Z7V0 | 77-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.