DPCstruct | MC3050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3GIZ0 | 120-200 | WCIERALDWGPGGGPDLVVDDGGDITLLIHEGVKAEEVYEKTRQLPDPASTDNAEFQIVLTIIRDGLMSDPKKHTGMSERL |
| A0A813HD73 | 110-190 | WCTEQMMTVPGADGCDQLVDDGGDATLLIHKGKEFEAKYAKDGSLPDPASTNNAEFKCILQLLKDSIPLDKTKYTRMAVQC |
| A0A5N6NUY1 | 25-114 | None |
| A0A151SJG3 | 125-205 | None |
| A0A0M0JY96 | 479-559 | None |
| A0A1R3JKA1 | 66-139 | None |
| A0A0D2MXV8 | 666-746 | None |
| A0A426ZKB9 | 254-334 | None |
| A0A3Q7J4F0 | 119-199 | None |
| A0A2G5CAS2 | 74-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.