DPCstruct | MC305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 398 |
|---|---|
| Mean domain length (aa) | 197 ± 38 aa |
| Standard deviation of domain lengths | 38.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | CL0126- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6K5Y3 | 14-234 | FEKQEIIQLLIVTLFTGFIFTFRDWGIESLDAGLGFTHLVLAILLALIALFFRVSVQKITGFAFGFNSTFMLWWAGLIISLVLVFIS… |
| A0A6N9Y2R2 | 5-183 | TVVVTVLYAALARRQLDLGPLGGYLVGLGFVISLLGSVLLHELGHALTARRYGIGVRGITLELLGGYTEMDRDAPSPRVELLISLAG… |
| A0A848WWR3 | 3-170 | None |
| A0A847CV07 | 10-207 | None |
| W7Z9P7 | 1-127 | None |
| A0A2M8Q2R6 | 197-416 | None |
| A0A2A2SKC5 | 11-212 | None |
| A0A3S0JY39 | 89-243 | None |
| A0A7W8QQK8 | 163-399 | None |
| A0A4Q9VMJ0 | 289-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.