DPCstruct | MC30497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 252 ± 49 aa |
| Standard deviation of domain lengths | 49.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.20 |
| Pfam Score | 89.84 |
| Assigned Pfam label(s) | PF08150- PF08165- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8WVU4 | 16-244 | GPRKPCIYMISYFEDHRCRMCIPNILERLYEYLNYGLDRFRFFTLRRQPHKARQWFRTLMRRLSKRITTVIQDVEGCRGTAMRTKLD… |
| A0A0S7J697 | 140-374 | AVFDGNHYYYLPWANTKPVVVLTSFWEDIGHRLDSVNIILYITHRLQSNLDAFKTAILAKAPDSQLVEVWMKLLDQLIEDLDSFPTP… |
| A0A814IBX1 | 282-523 | None |
| G3NZL8 | 586-859 | None |
| A0A182YBU6 | 98-381 | None |
| A0A6I9MTN4 | 8-371 | None |
| A0A817HM92 | 182-461 | None |
| A0A3L8DKQ7 | 2-321 | None |
| A0A7R9JHB7 | 230-468 | None |
| A0A2A3EF72 | 358-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.