DPCstruct | MC30494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0659 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4E0RUI5 | 2-72 | LDWHNEFRRKVLNCQLKGQPQAKTMPDMIYDAELAAKALQWASNCTVDHDADAGRATDKYPSIGQNFAGNY |
| A0A1S8WP77 | 21-94 | ETPDLMQFVDLHNDGRLRVQKGEIPGHPCAKYMPLVKWDKGLARKAQKWANKCRPEHDNRKNRKTSKFSVVGQN |
| A0A4Z2DFI1 | 4-104 | None |
| A0A183NAB9 | 1-78 | None |
| A0A183NCF6 | 18-117 | None |
| A0A183M8G7 | 1-115 | None |
| A0A183NWM5 | 11-111 | None |
| A0A3Q0KTE9 | 5-109 | None |
| A0A183WAF9 | 12-97 | None |
| A0A077ZE69 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.