DPCstruct | MC30493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3MQF1 | 1-156 | MFEVILTRVRGFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGAHEFTVEQCFGDGLHWAGCMIISLLGQQRRFDILD… |
| A0A1S8WLG2 | 17-177 | AKENEILTKERLCSGLVLFEYVLNRIREFLSEEDSGGSTWHGFLNPTKESSNGPTSSDILGLENCTYFHRIWSAIQLVFCTPFGQNE… |
| A0A3P7YBM3 | 308-487 | None |
| A0A0L8IGD7 | 139-316 | None |
| A0A183RJH3 | 82-285 | None |
| A0A1U7Z0X0 | 194-388 | None |
| A0A7C8Z689 | 158-319 | None |
| A0A0L0SWY3 | 1-161 | None |
| A0A443PDW8 | 88-285 | None |
| A0A1X7SSM3 | 32-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.