DPCstruct | MC30492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0398- PF11718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9CWL0 | 147-233 | ARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTV |
| A0A1S8WK84 | 1-92 | MLRLAGALQREYEDDDTCCLELFTPKNCVPVNLRFRGEKVAKVLGSLARNPPKNNQSISGVLVKKNFAYHILTPEELPTTFQTIGIQ… |
| A0A3P8HP74 | 9-96 | None |
| A0A812B9B2 | 879-964 | None |
| A0A7J7IFW4 | 20-115 | None |
| A0A0D3BVA9 | 49-132 | None |
| A0A6A6N370 | 742-824 | None |
| A0A1Y3NVA6 | 84-168 | None |
| A0A7S0JK14 | 248-330 | None |
| A0A820VZ08 | 95-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.