DPCstruct | MC3049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 42.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4E2P8 | 449-576 | VSGVHKKLKSELWKPEAFSQEFGDQDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFE… |
| A0A0B2QJT5 | 11-143 | TDEKAKDENRMDSEIDIELAQFMKGYFKGLILENGWPQLLKLKDWPSPSMAEEFLLYQRPEFINKLPLLQYIHSKWGLLNVAAKLPH… |
| A0A835HMF7 | 27-148 | None |
| A0A835HMF8 | 11-153 | None |
| A0A0A9DRV9 | 3-130 | None |
| A0A4Y7L6C6 | 2-150 | None |
| A0A0F7S5W5 | 11-109 | None |
| A0A7R9KWU6 | 786-932 | None |
| A0A0A9N5S0 | 2-112 | None |
| A0A438DKW3 | 522-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.