DPCstruct | MC30489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3MRE2 | 62-160 | YEEFKKLAIEDAEGGYRYGLECLFRFYSYGLEIHFSKDIFEDFQEMTVEDYCKKGELYGLEKFWAYLYYRKDKKTRPLDDKIRDELK… |
| A0A075AIP7 | 14-108 | EESARYGMECLFRFYSYGPEKRFRKAIFRDLQEEALREYDAGRLYGLEKIWAFLHYSRRKFEVEDRLQGLLDNRYRTSQDFRVNFQP… |
| T1F7D2 | 490-589 | None |
| A0A815PJN1 | 3-83 | None |
| A0A0D2MN98 | 2-115 | None |
| A0A0D2N4T0 | 90-207 | None |
| A0A820HL29 | 1-64 | None |
| F4PV76 | 511-629 | None |
| L5KA48 | 227-337 | None |
| A0A183J6M7 | 4-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.