DPCstruct | MC30487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4F9G7 | 7-67 | YCCQKLGSSCTGTVFRRCCGKLLCEYDMLGAGTCQNCIRSNYACMKNSQCCSKYCKFLVCV |
| A0A075A7Q8 | 8-72 | DLVDSKNLCATPDEECGTFKPCCGRHLICKRLGSAGQCVRCARDHEHCNRSSECCLGVCMNHTCR |
| G4VME9 | 43-115 | None |
| A0A183SLA6 | 49-104 | None |
| A0A183SLA5 | 3-53 | None |
| A0A3P6TRL8 | 173-232 | None |
| A0A4S2L9Q4 | 1-84 | None |
| A0A4S2LFZ6 | 50-109 | None |
| A0A448WC32 | 95-167 | None |
| A0A5K3FXI2 | 46-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.