DPCstruct | MC30482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 168 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7WRL7 | 814-965 | GQQSAAGTTQPGRCEAATSGSCSVGNLLSYFNNDQIKASNASQICNVESGGSEFALNDGCLSGKTYDFSVGLFQINLLAHRVVDPTT… |
| A0A1F6R4R5 | 1-150 | MCGEGGSCNSSFFESSTCFKGIYAVEAAQICFAESGGAVGAEGDTCVHNGANDKFSAGLFQINMIANGGMINTACAPKNIFNTYGIG… |
| A0A1F6IFS0 | 467-599 | None |
| A0A7T9QD40 | 203-375 | None |
| A0A7V6WJQ8 | 39-211 | None |
| A0A0G0MCB3 | 524-708 | None |
| A0A2M7H431 | 99-272 | None |
| A0A3D4RAZ2 | 925-1101 | None |
| A0A837HIQ8 | 1-168 | None |
| A0A3D4XY60 | 271-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.