DPCstruct | MC30481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672F5G3 | 26-92 | EVEVALPGLVLDLSSLVLYGAQAIPVRLKILLDRLYSVLTPEQVGHILHSLGWTLGDYVRGYMLQVP |
| A0A6P8GYA7 | 68-134 | QVEAVRASQVYDISSLMLFGAQAVPTRMKILLDRLYSVLPPADVRNILHSLGWTLRDYVRGYILQDT |
| A0A4Z2D6U2 | 36-135 | None |
| A0A183DNM0 | 88-187 | None |
| A0A5C6MX69 | 298-377 | None |
| A0A2J7RSM8 | 53-122 | None |
| A0A182EEF3 | 54-136 | None |
| A0A6L5DJT2 | 12-85 | None |
| A0A3Q2PIZ5 | 46-114 | None |
| A0A0K0E5H7 | 6-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.