DPCstruct | MC30475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4XI24 | 63-129 | CTGEAYKQTVKMTFAKGASVPDPAGLFNSSLDGSTRRAIDFREGDKVNEKALKALIQAAIAVNEACA |
| A9BVY3 | 1-65 | MKLTFPKGASLADPQHLFNASLEGKVRRAIDIREGEEIDAQAFKDLVREAAALNEAAARKRSPKG |
| A0A7L5ZAR0 | 123-181 | None |
| A0A536LIR0 | 46-112 | None |
| A0A7W0YV45 | 1-56 | None |
| K0I9Q0 | 178-242 | None |
| A0A840MQL3 | 74-142 | None |
| A0A7J4S2G9 | 11-69 | None |
| A0A2E0UIZ6 | 48-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.