DPCstruct | MC30473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.75 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF00095- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4K2R5 | 16-90 | VTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRP |
| A0A803SZY1 | 2-68 | EFPSTIKLGICPRNPFRCTIPGHNMCNNDYDCEGRQKCCYFNCGKICRNPQAIIKTLKRKHKHIPIR |
| A0A5E4BB88 | 33-98 | None |
| S9WCS6 | 77-133 | None |
| H9GTP1 | 45-118 | None |
| G1QG25 | 2-66 | None |
| A0A674IXY7 | 22-90 | None |
| A0A803TSW4 | 3-69 | None |
| A0A6P5QNE2 | 77-136 | None |
| L5LT13 | 54-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.