DPCstruct | MC3047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 189 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 79.13 |
| Assigned Pfam label(s) | PF01315- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0SZJ6 | 269-390 | GQAVMHQAAEVQVTGEAEYCDDIAKPVGTLHGALVMSTVPHARLVKVDPSAALAMPGVHGYFGAADVPHNDTGPVVYDEEVFASEFV… |
| A0A6A4TI10 | 240-370 | PEGQSLDDVVGRPMMHLSAMKQATGEAVYCDDVPLFENELYLSLVTSSKAHARIISIDTSAAERSPGVVCFLFADDIPGSNATGVIQ… |
| A0A6A2XG92 | 148-282 | None |
| A0A4S4EZI7 | 9-141 | None |
| A0A2P8ZIJ3 | 195-336 | None |
| A0A1W0X6H7 | 482-630 | None |
| K7IIE1 | 376-534 | None |
| K7IIE2 | 589-762 | None |
| A0A511D523 | 284-432 | None |
| A0A168LZP3 | 154-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.