DPCstruct | MC30467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9ISN9 | 59-128 | RIVREPRTMLRDEFGHDVPESVEVRVWDSSAELRYMVLPQRPPGTEDKSEAELAELVTRDSMIGVAPVRA |
| A0A1F4DHY5 | 47-115 | AVREPRAMLHELGLGLPDKVAVRVHDSTSDMRYLVLPMRPAGTEDLSESQFAALVTRDSMIGTTVLRAP |
| A0A7R9WNZ3 | 39-113 | None |
| A0A822F2K9 | 18-88 | None |
| A0A1Q7AK39 | 97-164 | None |
| A0A7W1LT99 | 2-70 | None |
| A0A537EYB9 | 250-320 | None |
| A0A0M3GIC3 | 117-187 | None |
| A0A852W5S5 | 125-194 | None |
| A0A7S0DJ60 | 147-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.