DPCstruct | MC30465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2B7Y3 | 111-223 | LIWDAIQIQYAAIIRSQQIMYVTDKNDKTIEKVGTQDGNVIGEKWEVQQAWDKQAGFLKAQSRAIDSLKSMIKDYLQLEGASKADAK… |
| A0A1C4FCL8 | 2-109 | LQYTQIIHAQRIMFIRDKEDMTKELRKKKLTESGFEEEWEIQFAWDKQASFLNAQSKAMSTLVTLIEKYDRLANTEEQKLRIEKLKK… |
| A0A0R2MQJ1 | 14-145 | None |
| A0A0U1L5H1 | 10-130 | None |
| A0A061NGD3 | 13-118 | None |
| C3GSR4 | 27-165 | None |
| A0A4R7U262 | 2-94 | None |
| A0A0R1V6N4 | 1-140 | None |
| A0A359B3V4 | 184-312 | None |
| A6BES7 | 17-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.