DPCstruct | MC3046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 241 ± 18 aa |
| Standard deviation of domain lengths | 17.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.79 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0022- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9AIE3 | 3-228 | YLQNADPALREYILKHSLPQIFQALLTGLCVSCPERPLHFLERKIVSIQENRDTVEIEWAWKRFIWNKRKEARELTLKMETAERHYI… |
| A0A6A4TGE4 | 1-218 | MPDSLPAFLLTELMMSCVHRHWKSFTSESKRDARESAMKVDKTKKHLDWKCQQVAVTKWVNWVKLHKKTNAAAVEKLERIVGAGRLK… |
| A0A3Q2UMM5 | 1-273 | None |
| A9UTZ9 | 391-626 | None |
| A0A5F4C538 | 1-241 | None |
| A0A813U1M5 | 71-321 | None |
| A0A2K6C5I5 | 1-215 | None |
| A0A060Y503 | 79-317 | None |
| A0A061IQM0 | 17-281 | None |
| A0A1I8G3M1 | 680-927 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.