DPCstruct | MC30459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 17.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B5FET6 | 12-105 | IVLAAPKVPETIEGKTDYLQEYEVQDLSAGNKPLWYAHFHYASLQAPDQQPTAAHLKTAAQRRLGREYENNTGQMVYRGPLANAAAR… |
| A0A0R3LQZ9 | 20-125 | ELAPADLPRALKGEPGTLFEIKLQPKALRNGAMPSPMWVHIHTKRPVLARQLATLDDADFAACHVKSNEQRGYNRQWQNARAATGHE… |
| A0A0K3A4E9 | 238-373 | None |
| A0A423KUM5 | 645-751 | None |
| A0A328YG89 | 195-324 | None |
| A0A5E7Q563 | 71-167 | None |
| A0A7Z7J685 | 1-120 | None |
| A0A7T4RM61 | 58-154 | None |
| A0A0Q8DF96 | 159-255 | None |
| A0A5E7AZC9 | 229-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.