DPCstruct | MC30449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 237 ± 47 aa |
| Standard deviation of domain lengths | 47.08 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818Y3J6 | 53-273 | PIYDKIKTAFIQSKLFIRISDLQNDSSSSLKKSKSSTERAPLTGISDIDEPLYELVDLFVRDYIEIWYKTQISSDESFIDDVKSGIY… |
| M2QX33 | 35-251 | LSAPKPKPVSLARRLLFPQLPADAPLPPLLSHPGAVPLDVELYDFIALALRAFVNPWWTKITRYDREFLPAITGVLAHVLRTLETRA… |
| B0X352 | 53-308 | None |
| A0A317WCC1 | 40-288 | None |
| A0A1J8PSF3 | 2-311 | None |
| A0A2A4JYB0 | 51-300 | None |
| A0A6V7U4U5 | 96-334 | None |
| R8BU33 | 4-213 | None |
| A0A4W2FVX5 | 72-340 | None |
| A0A364N161 | 114-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.