DPCstruct | MC30445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 161 ± 31 aa |
| Standard deviation of domain lengths | 30.78 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250XS05 | 700-894 | AKVRFRRLVGRNDKGVKANGERLEQELSEVRMEVAKYKNELRNIFNYYSMLTGPMASDKILSMNATQWLSFCEEAGILDNNQRGCTS… |
| D6PJ96 | 11-184 | KRLLGITRFRKVVGLTDELDAAFEESVFSSLKKYYVDCINLYEYYSCIDGTTQNPFVMGENAFTNIMIDSGISDEGGPCDPATLTRI… |
| A0A1V9ZXR4 | 581-769 | None |
| A0A835XVL2 | 138-315 | None |
| A0A7S0YQV7 | 520-647 | None |
| A0A812N8Y1 | 296-444 | None |
| A0A061QY04 | 836-1025 | None |
| A0A1Q9DYF6 | 326-512 | None |
| A0A7S2M1D5 | 268-412 | None |
| A0A7S1NUD2 | 149-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.