DPCstruct | MC30441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5DX24 | 9-80 | LTESARIQLEALDAVEEISPAGKIRYSEEFRSRAIREYETGRSPAQIFADAGFPLEIVGNKRIERALYRWRH |
| A0A1X2YR54 | 12-112 | PAKLLTADEALALGRRPEVVNVLKNKHGWWVIFTTQFQDEVTLRYLQGERPSEIFRSHNLGPEVLGYKRIERCVYRWVNHPSKSRVK… |
| A0A5J5DXC3 | 2-93 | None |
| A0A5M9ZUK3 | 14-100 | None |
| A0A261FEP8 | 2-88 | None |
| A0A7J5NKM7 | 1-88 | None |
| A0A2M9HBI0 | 33-143 | None |
| K2HAV8 | 3-90 | None |
| A0A229VWN5 | 2-94 | None |
| A0A6N7S902 | 27-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.