DPCstruct | MC3044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H6H5 | 1-119 | LSKGILEMKFMMKTKVKVDKEAEEDEGKHMYQNEITDKMGSNSNFLIEPSFVNIEELSVCRFSCRGMNPEIEKLLLNEKLGKEAATK… |
| C1C0J0 | 4-131 | LKSRPQKKKLSKNLLEMKFMKKTKEKEEQDQEDAEGQTLFRRDITKSMQKQGSRFIIEPSFAHIEDLIFGRLAYHGMNPAIEKQMQN… |
| A0A0B1TC47 | 44-171 | None |
| A0A1I8AB66 | 1-118 | None |
| A0A6P7TEE7 | 6-124 | None |
| A0A7R8X573 | 75-210 | None |
| A0A3S3PGH3 | 1-101 | None |
| A0A0N5BWE4 | 8-165 | None |
| A0A669QUB9 | 93-231 | None |
| A0A6L2PCR2 | 60-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.