DPCstruct | MC30438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 144 ± 26 aa |
| Standard deviation of domain lengths | 26.11 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | PF01327- PF00551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A076JGY8 | 8-140 | SIPFLSQPSAAAENTEEDLAVAQDLKDTLDAHRNGCVGMAANMIGVPKRIIAFVDEDFGGRIFVMFNPHITAEDGAFDTAEGCLSLQ… |
| A0A2N2BB76 | 3-80 | DIGDGPIIFINPVIEEVEGEQYGLEGCLSVPGKQGDVLRPYKIKVKAMDIEGTEFELEAEAFLARAICHEYDHLEGIL |
| A0A1Q6ZL90 | 2-130 | None |
| A0A815TY21 | 7-146 | None |
| A0A2M7QW97 | 12-151 | None |
| A0A534KCT9 | 9-170 | None |
| A0A1G6LKX5 | 2-150 | None |
| A0A7W1MAM0 | 157-306 | None |
| A0A7S2UMQ5 | 155-310 | None |
| A0A444XBU4 | 258-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.