DPCstruct | MC30437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 158 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127Q5P9 | 22-161 | IDNAMKFSHAIKDTFHEETYAHFGADPEQRAWNDIAWRVTEGNAQAAGDPMAWTLLEGEHGDNGKGTIRVLGANATTLTLELQAAAA… |
| B7MLE4 | 28-192 | NLITESVNPFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGRLDLNEVGNIRTIKDEFSPE… |
| A0A7I8FS93 | 4-117 | None |
| A0A6A8W0T0 | 65-204 | None |
| A0A2V4TYM9 | 334-488 | None |
| A0A1B9JMS3 | 260-459 | None |
| A0A146HTQ9 | 243-392 | None |
| A0A0N0IAL4 | 10-185 | None |
| A0A133XIR7 | 56-219 | None |
| A0A2J9HFT4 | 94-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.