DPCstruct | MC30435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 276 |
|---|---|
| Mean domain length (aa) | 247 ± 76 aa |
| Standard deviation of domain lengths | 75.76 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.63 |
| Pfam Score | 86.43 |
| Assigned Pfam label(s) | CL0374- CL0365- PF17297- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6IEF2 | 30-165 | FRRDRLHGSAVEVAGRGLLILGMSGAGKSRLALDLIGIGAGLIADDQVDLVRREDQVILSAPEPIRGMIEARGLGLLRCPAVGPVPL… |
| A0A6S6FXI8 | 36-281 | IGDDWLIGSRFDGVFRVDRAITRVRLYSAEMPPSAASVDVLVRRILPRLMAARGAATIHAAAVATAGAGLLLLGASGAGKSTTTAAL… |
| A0A1Q9CBJ7 | 181-523 | None |
| A0A1F6RGR7 | 414-665 | None |
| A0A7C0Y219 | 23-282 | None |
| A0A396QFR9 | 6-165 | None |
| A0A7X3Y4X9 | 549-760 | None |
| A0A1H6BNL6 | 61-339 | None |
| A0A6G6WSX6 | 1-310 | None |
| A0A416QN88 | 168-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.