DPCstruct | MC30432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Standard deviation of domain lengths | 19.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C4F621 | 57-195 | FEIARAHLLCFCTTLKHGLMPNLLDSVRTPRYNSRDSPWFMLQLLQEYVKYCKEGEAILGVQIKRRFPSSDEWVPWDSSIAYSEQLT… |
| A0A821WM50 | 118-225 | RYEEARYNARDAVWWWLYSTSNYTHIVPDGHDILSDKVSRLYPTHDSPAQSAGIHDQSLYDVIHEALLRHVQSLKFRERGAGHSLDF… |
| A0BFM0 | 30-160 | None |
| A0A6V7Y979 | 91-221 | None |
| E9IFN1 | 270-377 | None |
| A0A817XU87 | 14-89 | None |
| A0A814V5X0 | 612-743 | None |
| A0A814YCY8 | 7-139 | None |
| A0A0M3HLM9 | 14-113 | None |
| A0A3P8AVF1 | 1094-1207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.