DPCstruct | MC30430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820GV37 | 1-106 | MCPPHFCPLCQNHQSFSAFVSLYKHIRSIHRNDKTFNIRCSLNPGCGSAYTTFESYRSHLNRYHRDLLNDYSIQIDHSLNMTEHPSS… |
| A0A821VUP4 | 1-106 | MCPLYCCPLCQNHQPFPAFVILYKHIHSIHRNDIPFNLRCTLILTCVSVYTTFESYRSHLSRYHRDLLNDYDLSTYYTTCDNEQPPS… |
| A0A815JKF8 | 2-92 | None |
| A0A821R4X5 | 2-105 | None |
| A0A813UZP1 | 2-107 | None |
| A0A1X7TAM7 | 1-94 | None |
| A0A816TZW9 | 433-528 | None |
| A0A820VD18 | 1-106 | None |
| A0A818RKE7 | 3-108 | None |
| A0A816L0V2 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.