DPCstruct | MC3043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 49.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z7CZA2 | 256-342 | MDNVGMAAMFESLVATGLKGFLGCPAVIHEAALLEFFANGSVRDGLVVSTVNEVSVEISEQLLAETFELPVEGLTDLLEIPKDLVFD |
| A0A2Z7B2I9 | 7-89 | SRSHHIDFDSVFRFDDAEIVQMFESLVTTGLMEFLGCPSIFHESALIEFFANGSVRDDMVFSTISGIAVEISESVFSATFGLP |
| A0A2Z7C6I4 | 2-68 | None |
| A0A2Z7C472 | 56-150 | None |
| A0A2Z7C3N6 | 2-89 | None |
| A0A2Z7C3H8 | 7-92 | None |
| A0A2Z7C196 | 231-318 | None |
| A0A2Z7BYU2 | 8-78 | None |
| A0A2Z7BQL2 | 127-232 | None |
| A0A2Z7BR68 | 7-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.