DPCstruct | MC30428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1S779 | 42-175 | VQSTEPNLIECAVGEAKYEHVYRALVWRIPRLNEKQNAAYKSHLLRCRFELSSFDLMPDAFLPRCEVDFTMPLATVSNTVVRSVSVE… |
| A0A3P7XCV7 | 182-312 | KDRLMGTVHNVENSLIEAGIGEAKYEHVFRALVWRIPRLPEKFHAAYREHLLRCRFELSSFDLMPETFAPTCDVEFTMPLAMISNTV… |
| A0A7R8CUJ9 | 2-128 | None |
| A0A3M7S7V5 | 414-572 | None |
| A0A183EM47 | 139-288 | None |
| A0A7R9BH87 | 992-1148 | None |
| A0A7T8JV57 | 71-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.