DPCstruct | MC30425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T6U9 | 1-86 | ITSKLNPLKVCLGSVVELFASIMSKYEIVYCYSVIEENKRCYLPVLTTPTSGNTSLETIFPFDPYHLKRSSKYLIGLYREWNEDNE |
| A0A821UM88 | 3-102 | SELNPLKYSLPAITHRFAQLARNYQIVFCYSIIETNNRYTLPETFSTNDYLNGNLPSNILYSYFPFDPYVLKRSLIFIQTIYNDYRD… |
| H9G882 | 2-93 | None |
| A0A6P4FKC2 | 2-99 | None |
| A0A6V7HG28 | 374-478 | None |
| A0A815FCY9 | 13-125 | None |
| A0A6P4E4U4 | 2-102 | None |
| A0A2S7P2S9 | 114-234 | None |
| A0A818FXE1 | 64-170 | None |
| V8N8X5 | 314-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.