DPCstruct | MC30423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 130 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821U6W3 | 9-152 | LTDGINDNESNIVLQHNCLHVAAWIDEENDPYQIISYCMSEWSSKWNIRTTYQDQNFTFAELYKLNITSEQLYLWSAPMDVVEHYQF… |
| A0A814FZE8 | 10-90 | WPSKWNIEENIYDKKFTFYELYKQHITSQQIYLWSASMDIAEQYQLYLNQILITNETLLTTQVSYNCTQSRFGSICQYSFD |
| A0A813QHF1 | 16-156 | None |
| A0A814WIF4 | 16-151 | None |
| A0A820KNM4 | 3-117 | None |
| A0A820SLQ3 | 2-164 | None |
| A0A821HYJ4 | 16-136 | None |
| A0A816PD01 | 14-170 | None |
| A0A816QKL6 | 9-157 | None |
| A0A816RMN2 | 16-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.