DPCstruct | MC30422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 126 ± 22 aa |
| Standard deviation of domain lengths | 22.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448XE79 | 1-79 | MIHLPEGTKVDRSPLCEIVNFPIPEKPPDDLIKTPLIRVKDLDTVGQLLFDGIKKLNLVQSVVFETAYNTSENMLLAAP |
| A0A821U249 | 28-169 | SKILQSYSIDAFFVIKKYKELKNQFILLFDYDQLDFIKILKTHSHIKSHFIVRKICRLSNGSYRLQKKGYEEVHLCALKPSALDPEE… |
| A0A816KBL9 | 156-292 | None |
| A0A498LI20 | 335-467 | None |
| A0A137QYI8 | 1-94 | None |
| A0A0C9X4U2 | 358-453 | None |
| A0A395IK95 | 192-320 | None |
| A0A3M0IW95 | 410-540 | None |
| A0A0B7FTD7 | 175-306 | None |
| A0A0B2VTR2 | 563-706 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.