DPCstruct | MC3042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D1PR93 | 1-72 | MHLDVLQEKINNYLVYIEDKQYFKDYGDNFEKKIIDIKFQHSISENGMKFLNVVSSQLNDTDIFINIHLPGE |
| D4FS83 | 221-289 | HLEILQEKMNNYIHFLESKQYVARYGDKFDKKVIHIKLQYSPSDNGLAFLAAVQKVLQPTDMSLKVELP |
| A0A8B6N140 | 226-294 | None |
| A0A4T2H5Z2 | 1-79 | None |
| A0A0Z8I4R5 | 121-189 | None |
| A0A1I7EWR6 | 178-246 | None |
| A0A3R9LHY9 | 230-295 | None |
| A0A0F2DLB5 | 154-219 | None |
| A0A0Z8UB79 | 145-213 | None |
| A0A3R9H7D4 | 136-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.