DPCstruct | MC30409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 2 aa |
| Standard deviation of domain lengths | 1.55 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 64.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I2IV38 | 1-78 | ERFTSHGKRAVADAHGGTMSGAGFYTAYAIAMLNTLVGNLNTEGGLVLDAGPFPPYGAGPRYNIAGFANRPTPLGVAR |
| A0A378MWT7 | 71-150 | QTIENLAKKFTSHGHKANAITHGGTMHSTGFYTSWAILLLNAMVGNLNKKGGMAVAAGKFKDFGDGPRYNLANFPNEVKP |
| A0A381G6N3 | 1-83 | None |
| A0A3S4J240 | 41-122 | None |
| A0A6D2G8K1 | 1-83 | None |
| A0A1W9F0J7 | 215-294 | None |
| F4N7P9 | 166-247 | None |
| A0A3S5D4X9 | 29-109 | None |
| A0A379U0I9 | 127-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.