DPCstruct | MC30405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D4C830 | 1-88 | MEKRCWAVQIEGIHHIIEIEHESHGGTIWVDDRLFEKWILHGNRDSHHLFFIKGRRIGLHILYQPESNRYRYDLSVNGVSVIDGRDVP |
| A0A523UBP1 | 2-82 | AKKVWTFEVEGQRHVVELEHGYWSGKRDIVIDGVPFESSSKIYDTGSVHHFDISGVPCVLRIESKLLTFDYELYVGGKKVT |
| A0A136L6P7 | 1-88 | None |
| A0A1H8ZDL3 | 1-102 | None |
| A0A7S4E6F8 | 9-97 | None |
| A0A482VBC7 | 271-380 | None |
| A0A1M6IXK7 | 5-95 | None |
| A0A7C5CC71 | 1-88 | None |
| A0A821QSV6 | 487-571 | None |
| A0A317ZEU6 | 17-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.