DPCstruct | MC30402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 410 ± 81 aa |
| Standard deviation of domain lengths | 80.90 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0226- PF12999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9WKG2 | 17-358 | AAATSSIRGVAKSKLPLYDLSSGSFTCLDGSLNIPALSVNDDFCDCPDGSDEPGTSACPEGRFHCKNVWHVPAYIASSRVNDGVCDP… |
| A0A1X2HW74 | 20-411 | DIFQAVTRGVAPEQHSLYASNKFKSSGQWTCLDGSKTIPYAAVNDDYCDCPDGSDEPGTSACPNGRFYCENKGHIPAYIKSWSVNDG… |
| A0A6S8T6M1 | 2-312 | None |
| A0A812QML0 | 263-651 | None |
| A0A674HHD6 | 1-456 | None |
| A0A812QUN3 | 9-489 | None |
| A0A2A6CJ40 | 13-461 | None |
| A0A446PP73 | 12-386 | None |
| A0A2P4ZCT6 | 17-533 | None |
| A0A7N6AAH0 | 15-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.