DPCstruct | MC30401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 147 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2G995 | 214-342 | PVHKIVEGIEHLSFLYSHDRLVKEYTVRIDVDAINLDLVPTNFRDANTIYPRANVPREHYDGNRWEYESTCNSLGWKLCWLNKEQLC… |
| A0A1X2HVP3 | 1-156 | MPRRRSHTSVASVVSLSAHDPVCETRNGIEYITFLYSQDRLVRQYTVRTDIESIPPGGIPDDFCRLNAIYPRAHCAREHYDGNRWAY… |
| A0A0S6XSM5 | 56-201 | None |
| A0A1S8W4N7 | 3-155 | None |
| C4JLK3 | 41-207 | None |
| M1VXT2 | 294-465 | None |
| I1C4L0 | 54-207 | None |
| A0A1Y1XXA6 | 136-266 | None |
| X0LYP2 | 1-129 | None |
| A0A1C7NCP1 | 245-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.