DPCstruct | MC3040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 70.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024G5E7 | 251-443 | CSSEEQSRINQTIRNLYHPSLQGGWAVSTFQTRRYIAPITERDLLLAQCIDLQDRGYSRHEAAEIVYTHYAEPVVNAYTYAKYMSVG… |
| C4J9T1 | 1-125 | MSISGSSEDEHDIITLQYTEEGLLTIDENRDGRAAAFGDDIAIECLATEFKREVYVVQAHGADAMVDEDNCVFFLPHRPRGEVCEPP… |
| A0A445DAF0 | 160-307 | None |
| A0A811NY32 | 154-349 | None |
| A0A6V7P0M7 | 171-356 | None |
| A0A4Y1QPX8 | 6-152 | None |
| A0A6A6KY22 | 205-347 | None |
| A0A7I8J1M5 | 101-272 | None |
| M8CWJ2 | 23-201 | None |
| A0A7J7BY69 | 41-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.