DPCstruct | MC304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 74 ± 3 aa |
| Standard deviation of domain lengths | 3.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4EX39 | 1-65 | MSGRPRRAASASERARVSVTRAVRQAMARLGERHPLLAQHLDRTIRTGTYCGYFPDPRAPVSWTL |
| A0A6N9Y1U3 | 1-76 | RAALLDQLRAAAGLAGRTRRLGDQAERARKAVTGRIRDTLRRIDERHPALAAHLRESVTTGGACRYRPAEPVPWRL |
| A0A838KBM2 | 59-133 | None |
| A0A6B2DVI6 | 1-71 | None |
| A0A7W1R205 | 24-99 | None |
| A0A7W8VG13 | 86-160 | None |
| A0A7W1I726 | 1143-1216 | None |
| A0A2S4Z3R3 | 963-1038 | None |
| A0A661N4D6 | 387-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.