DPCstruct | MC30396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 298 ± 42 aa |
| Standard deviation of domain lengths | 41.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286AL63 | 17-352 | IKPQTFSGSGSDPDALIPVSEFIKYVEAFEQEYPNFSPEQTLTYIRQWYYNSVLGIEGLKFRTLIPDAGIITAPPPIWVDRNRFFQS… |
| A0A7J0C512 | 167-502 | TSNVLSHFKGIVDALAADGGRFGIGVYGPRNVCTRVGEAGHSTASFVSDMSSGFSGNFGYPLPADWAYDQIVTRTFGSGTGAIEIDV… |
| A0A498NTL0 | 1-266 | None |
| A0A7R9PXI2 | 1-385 | None |
| W9WKA0 | 51-337 | None |
| A0A101PFU3 | 33-226 | None |
| A0A2N3W735 | 5-306 | None |
| Q093B6 | 49-356 | None |
| A0A7W1XR83 | 214-501 | None |
| A0A510WF11 | 580-860 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.